Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ)

This Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein ybdJ

UniProt

P77506

Expression Region

1-82

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL VLGAIEYFVLRFIWRRWFSLAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS704418 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Ipragliflozin
TRC-I739475-10MG 10 mg

Ipragliflozin

Sign In for Pricing
View Details
Thiazine Red R
TRC-T344610-250MG 250 mg

Thiazine Red R

Sign In for Pricing
View Details
Recombinant Human Cyclophilin D/PPID Protein (His Tag)
PKSH032874-01 10 µg

Recombinant Human Cyclophilin D/PPID Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Cyclophilin D/PPID Protein (His Tag)
PKSH032874-02 50 µg

Recombinant Human Cyclophilin D/PPID Protein (His Tag)

Sign In for Pricing
View Details
Human PALB2 activation kit by CRISPRa
GA112582 1 Kit

Human PALB2 activation kit by CRISPRa

Sign In for Pricing
View Details