Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit c (atpE)

This Recombinant Shewanella amazonensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SBU5

Expression Region

1-83

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGFTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALYMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP1/ABCC1 Rabbit pAb (APR25080N)
APR25080N-01 50 µL

MRP1/ABCC1 Rabbit pAb (APR25080N)

Sign In for Pricing
View Details
MRP1/ABCC1 Rabbit pAb (APR25080N)
APR25080N-02 100 µL

MRP1/ABCC1 Rabbit pAb (APR25080N)

Sign In for Pricing
View Details
MRP1/ABCC1 Rabbit pAb (APR25080N)
APR25080N-03 200 µL

MRP1/ABCC1 Rabbit pAb (APR25080N)

Sign In for Pricing
View Details
Sirt1 (NM_001159590) Mouse Tagged ORF Clone Lentiviral Particle
MR227270L4V 200 µL

Sirt1 (NM_001159590) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DYRK2 Peptide - C-terminal region
orb2007712 100 µg

DYRK2 Peptide - C-terminal region

Sign In for Pricing
View Details
STK3 Rabbit mAb
MBS9469810-01 0.05 mL

STK3 Rabbit mAb

Sign In for Pricing
View Details