Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Peptide - C-terminal region

DYRK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYRK2 Rabbit Polyclonal Antibody (orb585932) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003574

Preservative

Lyophilized powder

AA Sequence

LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vmn2r8 shRNA (UAS) - Lentiviral mouse Vmn2r8 shRNA (UAS, GFP) plasmid
GTR15161506 1 Vial

Lentiviral mouse Vmn2r8 shRNA (UAS) - Lentiviral mouse Vmn2r8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
UFSP2 ORF Vector (Human) (pORF)
ORF011304 1.0 µg DNA

UFSP2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human STARD3NL knockout cell line
ABC-KH14772 1 Vial

Human STARD3NL knockout cell line

Sign In for Pricing
View Details
Goose Shootin-1 (KIAA1598) ELISA Kit
MBS9942597 Inquire

Goose Shootin-1 (KIAA1598) ELISA Kit

Sign In for Pricing
View Details
Mouse DNA repair protein RAD52 homolog, Rad52 ELISA KIT
ELI-35550m 96 Tests

Mouse DNA repair protein RAD52 homolog, Rad52 ELISA KIT

Sign In for Pricing
View Details
Recombinant Clostridium acetobutylicum GTPase obg (obg)
MBS1409887-01 0.02 mg (E-Coli)

Recombinant Clostridium acetobutylicum GTPase obg (obg)

Sign In for Pricing
View Details