Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta gronovii Cytochrome b559 subunit alpha (psbE)

This Recombinant Cuscuta gronovii Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-84.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8MAV7

Expression Region

2-84

Origin

Cuscuta gronovii (Common dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENQQ GIPLITGRFEPLEEQNEFSRRSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycidyl Stearate-13C3
HY-W747639 1 Each

Glycidyl Stearate-13C3

Sign In for Pricing
View Details
PROTAC CYP1B1 degrader-1
HY-146393-01 1 mg

PROTAC CYP1B1 degrader-1

Sign In for Pricing
View Details
PROTAC CYP1B1 degrader-1
HY-146393-02 5 mg

PROTAC CYP1B1 degrader-1

Sign In for Pricing
View Details
PROTAC CYP1B1 degrader-1
HY-146393-03 10 mg

PROTAC CYP1B1 degrader-1

Sign In for Pricing
View Details
Oligomycin A
sc-201551B 100 mg

Oligomycin A

Sign In for Pricing
View Details
RPL27P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1953908 1.0 µg DNA

RPL27P7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details