Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yjdJ (yjdJ)

This Recombinant Bacillus subtilis Uncharacterized protein yjdJ (yjdJ) spans the amino acid sequence from region 26-109.

Product Specifications

Product Name Alternative

Uncharacterized protein yjdJ

UniProt

O31651

Expression Region

26-109

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YQGSELVSDRFDWNYTAKLSKLLNGIDAVSSPKQISQLDFFIYSAKHYPVMSALMIISFL YVLAALFLLIYSVKCNKQEIHLDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AOF1, ID (Flavin-containing amine oxidase domain-containing protein 1, Lysine-specific histone demethylase 2, Lysine-specific histone demethylase 1B, LSD2, C6orf193, AOF1, KDM1B) (AP) discontinued
031934-AP 200 µL

AOF1, ID (Flavin-containing amine oxidase domain-containing protein 1, Lysine-specific histone demethylase 2, Lysine-specific histone demethylase 1B, LSD2, C6orf193, AOF1, KDM1B) (AP) discontinued

Sign In for Pricing
View Details
GHBP Human
OM300955-01 5 µg

GHBP Human

Sign In for Pricing
View Details
GHBP Human
OM300955-02 20 µg

GHBP Human

Sign In for Pricing
View Details
GHBP Human
OM300955-03 1 mg

GHBP Human

Sign In for Pricing
View Details
2- (Dimethylamino) ethyl 2-hydroxyacetate hydrochloride
RPD13814-01 50 mg

2- (Dimethylamino) ethyl 2-hydroxyacetate hydrochloride

Sign In for Pricing
View Details
2- (Dimethylamino) ethyl 2-hydroxyacetate hydrochloride
RPD13814-02 0.5 g

2- (Dimethylamino) ethyl 2-hydroxyacetate hydrochloride

Sign In for Pricing
View Details