GHBP Human
Growth Hormone Binding Protein Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 248 amino acids and having a molecular mass of 28107.01 Dalton.
Product Specifications
Swiss Prot
P10912
Source
Escherichia Coli.
Buffer
GHBP was lyophilized from a concentrated (1 mg/mL) solution with 045mM NaHCO3.
Storage Conditions
Lyophilized Growth Hormone Binding Protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
AFSGSEATAAILSRAPWSLQSVNPGLKTNS SKEPKFTKCRSPERETFSCHWTDEVHHGTK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
