Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bladder cancer-associated protein (BLCAP)

This Recombinant Human Bladder cancer-associated protein (BLCAP) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Bladder cancer-associated protein, Bladder cancer 10 kDa protein, Bc10

UniProt

P62952

Expression Region

1-87

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology; Kidney & Urological Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TGFB1/TGF-beta 1 Protein
PKSH032007-01 10 µg

Recombinant Human TGFB1/TGF-beta 1 Protein

Sign In for Pricing
View Details
Recombinant Human TGFB1/TGF-beta 1 Protein
PKSH032007-02 50 µg

Recombinant Human TGFB1/TGF-beta 1 Protein

Sign In for Pricing
View Details
Tolfenamic Acid Acyl-Beta-D-Glucuronide Benzyl Ester
TRC-T535315-10MG 10 mg

Tolfenamic Acid Acyl-Beta-D-Glucuronide Benzyl Ester

Sign In for Pricing
View Details
2-Benzylamino-2-phenylbutanol
TRC-B225990-10MG 10 mg

2-Benzylamino-2-phenylbutanol

Sign In for Pricing
View Details
8-(4-Bromobutyl)-8-azaspiro[4.5]decane-7,9-dione
TRC-B681970-50MG 50 mg

8-(4-Bromobutyl)-8-azaspiro[4.5]decane-7,9-dione

Sign In for Pricing
View Details
ADAMTS8 Rabbit Polyclonal Antibody
TA371757 100 µL

ADAMTS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details