Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE)

This Recombinant Bacillus subtilis Spore morphogenesis and germination protein ywcE (ywcE) spans the amino acid sequence from region 1-87.

Product Specifications

Product Name Alternative

Spore morphogenesis and germination protein ywcE

UniProt

P39603

Expression Region

1-87

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDMFFAYLLVASATPLFIWLDNKKVALSAIPPIILMWVFFFFYATESLSPLGHTLMIIL FAVNVIVAHIAAFIIYGLPYLRRKRSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taf10 Mouse Gene Knockout Kit (CRISPR)
KN517136 1 Kit

Taf10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ProtoBlot Rapid Western Transfer Buffer
EC-878 1 L

ProtoBlot Rapid Western Transfer Buffer

Sign In for Pricing
View Details
HOGA1 Human qPCR Primer Pair (NM_138413)
HP216968 200 Reactions

HOGA1 Human qPCR Primer Pair (NM_138413)

Sign In for Pricing
View Details
CYP20A1 (Center) Rabbit Polyclonal Antibody
AP51165PU-N 400 µL

CYP20A1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF647 conjugate, 0.1mg/mL
BNC472837-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2837), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS703012 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details