Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 2 Envelope protein US9 (US9)

This Recombinant Human herpesvirus 2 Envelope protein US9 (US9) spans the amino acid sequence from region 1-89.

Product Specifications

Product Name Alternative

Envelope protein US9, 10 kDa protein

UniProt

P89477

Expression Region

1-89

Origin

Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSRPADQDSVRSSASVPLYPAASPVPAEAYYSESEDEAANDFLVRMGRQQSVLRRRRRR TRCVGLVIACLVVALLSGGFGALLVWLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myclobutanil hydroxide
MBS5813880 Inquire

Myclobutanil hydroxide

Sign In for Pricing
View Details
CD1B (M-T101) Alexa Fluor® 546
sc-58975 AF546 200 µg/mL

CD1B (M-T101) Alexa Fluor® 546

Sign In for Pricing
View Details
Canine α1 macroglobulin, α1-MG GENLISA ELISA
KLN0182 96 Well

Canine α1 macroglobulin, α1-MG GENLISA ELISA

Sign In for Pricing
View Details
Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)
TRV-0019314-01 10 µg

Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)

Sign In for Pricing
View Details
Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)
TRV-0019314-02 50 µg

Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)

Sign In for Pricing
View Details
Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)
TRV-0019314-03 100 µg

Eukaryotic Chemokine C-X-C-Motif Ligand 16 (CXCL16)

Sign In for Pricing
View Details