Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Microcin-24 immunity protein (mtfI)

This Recombinant Microcin-24 immunity protein (mtfI) spans the amino acid sequence from region 1-93.

Product Specifications

Product Name Alternative

Microcin-24 immunity protein

UniProt

Q46970

Expression Region

1-93

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFLNFAFSPVFFSIMACYFIVWRNKRNEFVCNRLLSIIIISFLICFIYPWLNYKIEVKY YIFEQFYLFCFLSSLVAVVINLIVYFILYRRCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC89 CRISPR/Cas9 KO Plasmid (m)
sc-427606 20 µg

CCDC89 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Rabbit Polyclonal CDAN1 Antibody
NBP1-84574-25ul 25 µL

Rabbit Polyclonal CDAN1 Antibody

Sign In for Pricing
View Details
BC049762 3'UTR GFP Stable Cell Line
TU152623 1.0 mL

BC049762 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Putative serine protease 46 (PRS46), Biotinylated
orb3005517-01 20 µg

Recombinant Human Putative serine protease 46 (PRS46), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Putative serine protease 46 (PRS46), Biotinylated
orb3005517-02 100 µg

Recombinant Human Putative serine protease 46 (PRS46), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Putative serine protease 46 (PRS46), Biotinylated
orb3005517-03 1 mg

Recombinant Human Putative serine protease 46 (PRS46), Biotinylated

Sign In for Pricing
View Details