Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative serine protease 46 (PRS46), Biotinylated

This Recombinant Human Putative serine protease 46 (PRS46), Biotinylated spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative serine protease 46; EC 3.4.21.-; Serine protease 46 pseudogene; PRSS46P PRSS46

UniProt

E5RG02

Expression Region

1-174

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C (CYCS) (NM_018947) Human Over-expression Lysate
LC402715 20 µg

Cytochrome C (CYCS) (NM_018947) Human Over-expression Lysate

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3,5-Dinitrosalicylic Acid
TRC-D480300-5G 5 g

3,5-Dinitrosalicylic Acid

Sign In for Pricing
View Details
Human Apc4 (ANAPC4) activation kit by CRISPRa
GA109330 1 Kit

Human Apc4 (ANAPC4) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SOD2 Monoclonal Antibody
AN300261P 100 µL

Recombinant SOD2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PGAM1 Monoclonal Antibody
AN301626L-01 50 µL

Recombinant PGAM1 Monoclonal Antibody

Sign In for Pricing
View Details