Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thiomicrospira crunogena ATP synthase subunit c (atpE)

This Recombinant Thiomicrospira crunogena ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-94.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q31DL5

Expression Region

1-94

Origin

Thiomicrospira crunogena (strain XCL-2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAQFIADIYAATAIGVGVILAAAGLGSAIGWGLICSKTLEGIARQPEMRPALMTNMFIF AGLMESFPFIILAFAMWFLFANPFVGAMQAALGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ionomycin
SIH-228-5MG 5 mg

Ionomycin

Sign In for Pricing
View Details
CD1b (RIV12), CF640R conjugate, 0.1mg/mL
BNC400317-500 1x 500 µL

CD1b (RIV12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human IFNα2b/IFNA2 Protein
PKSH033640-01 10 µg

Recombinant Human IFNα2b/IFNA2 Protein

Sign In for Pricing
View Details
Recombinant Human IFNα2b/IFNA2 Protein
PKSH033640-02 50 µg

Recombinant Human IFNα2b/IFNA2 Protein

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
RD-SEPP1-Hu-01 96 Tests

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details
Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit
RD-SEPP1-Hu-02 48 Tests

Human Selenoprotein P1, Plasma (SEPP1) ELISA Kit

Sign In for Pricing
View Details