Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Proton channel protein M2

UniProt

Q289M6

Expression Region

1-96aa

Tag

C-terminal 6xHis-tagged

Source

In vitro E.coli expression system

Origin

Influenza A virus (strain A/New Zealand:South Canterbury/35/2000 H1N1)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFSKSIYRIFKHGLKRGPSTEGVPESMREEYREEQQNAVDADDGHFVSIEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD5 Rabbit mAb
F1052-100uL 100 µL

SMAD5 Rabbit mAb

Sign In for Pricing
View Details
CKLF Rabbit Polyclonal Antibody (HRP)
orb2115059 100 µL

CKLF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Chicken Polyclonal ENC1 Antibody [DyLight 405]
NBP1-77146V 0.1 mL

Chicken Polyclonal ENC1 Antibody [DyLight 405]

Sign In for Pricing
View Details
Phospho-Dnmt3a (Ser390 + Ser393) Polyclonal Antibody, Cy7 Conjugated
bs-14399R-Cy7 100 µL

Phospho-Dnmt3a (Ser390 + Ser393) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
4,5,6,7-Tetrahydro-1H-indole
OR350389-01 100 mg

4,5,6,7-Tetrahydro-1H-indole

Sign In for Pricing
View Details
4,5,6,7-Tetrahydro-1H-indole
OR350389-02 250 mg

4,5,6,7-Tetrahydro-1H-indole

Sign In for Pricing
View Details