Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Coiled-coil domain-containing protein 56 (ccdc56)

This Recombinant Danio rerio Coiled-coil domain-containing protein 56 (ccdc56) spans the amino acid sequence from region 1-96.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

A8KB87

Expression Region

1-96

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSQGEPKPEAQFAKRIDPTKEALTKEQLQFIRQVEMAQWKKKTDKLRGRNVATGLAIGA VVLGIYGYTFYSVSQEKIMDEIDEEAKVRVPKTGAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactulose Fluorometric Assay Kit
E-BC-F049 96 T (40 samples)

Lactulose Fluorometric Assay Kit

Sign In for Pricing
View Details
FAM3C Antibody
KC-29584-01 50 μL

FAM3C Antibody

Sign In for Pricing
View Details
FAM3C Antibody
KC-29584-02 100 µL

FAM3C Antibody

Sign In for Pricing
View Details
FAM3C Antibody
KC-29584-03 1 mL

FAM3C Antibody

Sign In for Pricing
View Details
OR2T5 (NM_001004697) Human Over-expression Lysate
LY423885 100 µg

OR2T5 (NM_001004697) Human Over-expression Lysate

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (N-term) Rabbit Polyclonal Antibody
AP23390PU-N 100 µg

Apolipoprotein A I (APOA1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details