Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M2)

This Recombinant Influenza A virus Matrix protein 2 (M2) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2

UniProt

A3DRP1

Expression Region

1-97

Origin

Influenza A virus (strain A/USA:Memphis/10/1996 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGIVHLILWIIDRLFFKCIYRIFKHGLK RGPSTEGVPESMREEYREEQQNAVDADEGHFVSIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)
KN202896 1 Kit

Cystatin SN (CST1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL
BNC682408-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2408), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASMTL (NM_001173474) Human Over-expression Lysate
LY433335 100 µg

ASMTL (NM_001173474) Human Over-expression Lysate

Sign In for Pricing
View Details
AR A014418
SIH-492-5MG 5 mg

AR A014418

Sign In for Pricing
View Details
SUFU Rabbit Polyclonal Antibody
ER1802-68 100 µL

SUFU Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-His-tag | 3xHis (polyclonal) - DyLight® 488 conjugated (40 µg)
AS20 4441-DL488 40 µg

Anti-His-tag | 3xHis (polyclonal) - DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details