Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN)

This Recombinant Methanococcus maripaludis Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

A4FW42

Expression Region

1-97

Origin

Methanococcus maripaludis (strain C5 / ATCC BAA-1333)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFKHVLMILGVIILILAPLIMYSGLGEDEGYFGGADGAAGDLIMEISPNYEPWFEPFWE PPSGEIESLLFALQAAIGAIIIGYFFGYNKAKYEDKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin 3 (SEPT3) Human qPCR Primer Pair (NM_145733)
HP225935 200 Reactions

Septin 3 (SEPT3) Human qPCR Primer Pair (NM_145733)

Sign In for Pricing
View Details
MMP14 Rabbit Polyclonal Antibody
TA368852 100 µL

MMP14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199M-01 50 Tests

Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199M-02 100 Tests

Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]
E-AB-F1199M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[HIT11]
E-AB-F1311D-01 20 Tests

PE Anti-Human CD2 Antibody[HIT11]

Sign In for Pricing
View Details