Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

Q67211

Expression Region

1-97

Origin

Influenza A virus (strain A/Wisconsin/3523/1988 H1N1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETPIRNEWGCKCNDSSDPLVAAASIIGILHLILWILDRLFLKCIYRRFKYGLK RGPSTEGVPESMREEYRQKQQSAVDVDDGHFVNIVLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNA14 Mouse Monoclonal Antibody [Clone ID: OTI3E8]
CF812023 100 µg

GNA14 Mouse Monoclonal Antibody [Clone ID: OTI3E8]

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800657 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
SERINC5 Human Gene Knockout Kit (CRISPR)
KN424636 1 Kit

SERINC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WP1130
SIH-337-5MG 5 mg

WP1130

Sign In for Pricing
View Details
Recombinant Syntaxin-3 Antibody
RC-6868-01 50 μL

Recombinant Syntaxin-3 Antibody

Sign In for Pricing
View Details
Recombinant Syntaxin-3 Antibody
RC-6868-02 100 µL

Recombinant Syntaxin-3 Antibody

Sign In for Pricing
View Details