Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167)

This Recombinant Mouse Coiled-coil domain-containing protein 167 (Ccdc167) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q9D162

Expression Region

1-97

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTKKKRENLGVAQEIDGLEEKLSRCRKDLEAVTSQLYRAELSPEDRRSLEKEKHTLMNKA SKYEKELKLLRHENRKNTLLSVAIFTVFALLYAYWTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRICH1 Adenovirus (Mouse)
38271055 1.0 mL

QRICH1 Adenovirus (Mouse)

Sign In for Pricing
View Details
CBX8 (chromobox homolog 8 (Pc class homolog, Drosophila), Chromobox protein homolog 8, hPc3, HPC3, Pc3, PC3, Polycomb 3 Homolog, RC1, Rectachrome 1) (FITC) discontinued
C2098-87B-FITC 100 µL

CBX8 (chromobox homolog 8 (Pc class homolog, Drosophila), Chromobox protein homolog 8, hPc3, HPC3, Pc3, PC3, Polycomb 3 Homolog, RC1, Rectachrome 1) (FITC) discontinued

Sign In for Pricing
View Details
ECHDC3 Protein Vector (Mouse) (pPB-C-His)
PV174334 500 ng

ECHDC3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
EF-HA1 shRNA Plasmid (h)
sc-105321-SH 20 µg

EF-HA1 shRNA Plasmid (h)

Sign In for Pricing
View Details
SOD1-Derlin-1 inhibitor-2
HY-123982-01 5 mg

SOD1-Derlin-1 inhibitor-2

Sign In for Pricing
View Details
SOD1-Derlin-1 inhibitor-2
HY-123982-02 10 mM - 1 mL

SOD1-Derlin-1 inhibitor-2

Sign In for Pricing
View Details