Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-97.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T5

Expression Region

1-97

Origin

Influenza A virus (strain A/Hong Kong/212/2003 H5N1 genotype Z+)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETHTRNEWECRCSDSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLK RGPATAGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIK (M27) polyclonal antibody
BS1034-01 50 µL

BIK (M27) polyclonal antibody

Sign In for Pricing
View Details
BIK (M27) polyclonal antibody
BS1034-02 100 µL

BIK (M27) polyclonal antibody

Sign In for Pricing
View Details
Zbtb43 Rabbit Polyclonal Antibody (HRP)
orb2128067 100 µL

Zbtb43 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
LAIR1 Polyclonal Antibody
MBS2572769-01 0.06 mL

LAIR1 Polyclonal Antibody

Sign In for Pricing
View Details
LAIR1 Polyclonal Antibody
MBS2572769-02 0.12 mL

LAIR1 Polyclonal Antibody

Sign In for Pricing
View Details
LAIR1 Polyclonal Antibody
MBS2572769-03 0.2 mL

LAIR1 Polyclonal Antibody

Sign In for Pricing
View Details