Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MANBAL (MANBAL)

This Recombinant Human Protein MANBAL (MANBAL) spans the amino acid sequence from region 1-85.

Product Specifications

Product Name Alternative

Protein MANBAL

UniProt

Q9NQG1

Expression Region

1-85

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASDLDFSPPEVPEPTFLENLLRYGLFLGAIFQLICVLAIIVPIPKSHEAEAEPSEPRSA EVTRKPKAAVPSVNKRPKKETKKKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae Protein STU2 (STU2) , partial
MBS1102191 Inquire

Recombinant Saccharomyces cerevisiae Protein STU2 (STU2) , partial

Sign In for Pricing
View Details
AASDH Protein Vector (Human) (pPB-C-His)
PV048477 500 ng

AASDH Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-South American/Mojave rattlesnake crotoxin Antibody (Al0G)
RWN27401 100 μg

Anti-South American/Mojave rattlesnake crotoxin Antibody (Al0G)

Sign In for Pricing
View Details
CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (MaxLight 550)
125491-ML550 100 µL

CX3CL1 (Fractalkine, C-X3-C Motif Chemokine 1, CX3C Membrane-anchored Chemokine, Neurotactin, Small-inducible Cytokine D1, FKN, NTT, SCYD1, A-152E5.2) (MaxLight 550)

Sign In for Pricing
View Details
NET-4 CRISPR Activation Plasmid (m2)
sc-425048-ACT-2 20 µg

NET-4 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Goat Anti-Rabbit IgG Fc-HRP
MBS675104-01 1 mL

Goat Anti-Rabbit IgG Fc-HRP

Sign In for Pricing
View Details