Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167)

This Recombinant Danio rerio Coiled-coil domain-containing protein 167 (ccdc167) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 167

UniProt

Q5RHZ2

Expression Region

1-100

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRTRTVKKEKISVASEIDRVEERKLQCKNSLERAEFRKRKQQLSDDDRLALEDEMTILN ERVEKYEKDLQVLRGENRRNMMLSVALLAISALFYYTFIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chaetomellic acid A
HY-134579 1 Each

Chaetomellic acid A

Sign In for Pricing
View Details
Aox3 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4878502 1.0 µg DNA

Aox3 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
AGK Protein Lysate (Mouse) with C-HA Tag
11520034 100 µg

AGK Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
SLC7A4 CRISPRa sgRNA lentivector (set of three targets)(Rat)
44280126 3x 1.0µg DNA

SLC7A4 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
EYA1 (NM_172058) Human Tagged Lenti ORF Clone
RC221561L4 10 µg

EYA1 (NM_172058) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Olr363 (NM_001000754) Rat Tagged ORF Clone Lentiviral Particle
RR211536L4V 200 µL

Olr363 (NM_001000754) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details