Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. UPF0060 membrane protein ACIAD1364 (ACIAD1364)

This Recombinant Acinetobacter sp. UPF0060 membrane protein ACIAD1364 (ACIAD1364) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ACIAD1364

UniProt

Q6FCI0

Expression Region

1-101

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTALAEILGCYFPYLILKEGKTHWLWLPAIISLAVFVWLLTLHPAASGRIYAAYGGIYIF TALMWLRFIDQVTLTRWDIWGGTVVLLGAALIILQPQGLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIS3L2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9053R-BF594 100 µL

DIS3L2 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Phospho-DNA-PKcs (Ser3191) Polyclonal Antibody
bs-10994R 100 µL

Phospho-DNA-PKcs (Ser3191) Polyclonal Antibody

Sign In for Pricing
View Details
LASP1 Antibody, FITC conjugated
A40551-50UG 50 µg

LASP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
VEGFC Antibody
F40190-0.4ML 0.4 mL

VEGFC Antibody

Sign In for Pricing
View Details
HDAC4 Rabbit pAb, PerCP-Cy7 conjugated
orb2892029 100 µL

HDAC4 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
ZNF143 (Zinc Finger Protein 143, SPH-binding Factor, SBF, Selenocysteine tRNA Gene Transcription-activating Factor, hStaf, STAF, pHZ-1) (MaxLight 405) discontinued
135604-ML405 100 µL

ZNF143 (Zinc Finger Protein 143, SPH-binding Factor, SBF, Selenocysteine tRNA Gene Transcription-activating Factor, hStaf, STAF, pHZ-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details