Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q79ZV3

Expression Region

1-101

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OMI Antibody
3319-01 0.02 mg

OMI Antibody

Sign In for Pricing
View Details
OMI Antibody
3319-02 0.1 mg

OMI Antibody

Sign In for Pricing
View Details
ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)
MBS647750-01 0.1 mg

ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)

Sign In for Pricing
View Details
ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)
MBS647750-02 5x 0.1 mg

ASAHL (N-acylethanolamine-hydrolyzing Acid Amidase, Acid Ceramidase-like Protein, N-acylsphingosine Amidohydrolase-like, ASAH-like Protein, NAAA, PLT)

Sign In for Pricing
View Details
Anti-DEP1  (6G11)
YF-MA15050 100 ug

Anti-DEP1 (6G11)

Sign In for Pricing
View Details
Human Carbonic Anhydrase 3 Recombinant Protein C-6 His Tag
MBS8431422-01 0.05 mg

Human Carbonic Anhydrase 3 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details