Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C6orf50 (C6orf50)

This Recombinant Human Putative uncharacterized protein C6orf50 (C6orf50) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C6orf50, Nasopharyngeal carcinoma-associated gene 19 protein

UniProt

Q9HD87

Expression Region

1-102

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANTQLDHLHYTTEFTRNDLLIICKKFNLMLMDEDIISLLAIFIKMCLWLWKQFLKRGSK CSETSELLEKVKLQLAFTAYKYVDICFPEQMAYSRYIRWYIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FPS-ZM1
SIH-561-5MG 5 mg

FPS-ZM1

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS707545 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
CATSPERE Rabbit Polyclonal Antibody
TA365550 100 µL

CATSPERE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (BF1.1), CF488A conjugate, 0.1mg/mL
BNC882283-500 1x 500 µL

Calcineurin A / PPP3CA (BF1.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KDM2B Rabbit Polyclonal Antibody
TA368615 100 µL

KDM2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MPC1L activation kit by CRISPRa
GA117646 1 Kit

Human MPC1L activation kit by CRISPRa

Sign In for Pricing
View Details