Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R694 (MIMI_R694) spans the amino acid sequence from region 1-111.

Product Specifications

Product Name Alternative

Uncharacterized protein R694

UniProt

Q5UNU8

Expression Region

1-111

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHFSRCFDECSKIERPNVNKKLTRLIIVLFCLLCIIVTLGVIGYKFLFKMSYVDAIYNT AITTSTLGIAPGDKTDAEKIFTGIYAVLVGVFFISVISAIVSYMFTTYILD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Myb Recombinant Rabbit Monoclonal Antibody [JE40-07]
HA721514 100 µL

c-Myb Recombinant Rabbit Monoclonal Antibody [JE40-07]

Sign In for Pricing
View Details
Recombinant Human PIK3R5 protein (His tag)
PDEH100963-01 20 µg

Recombinant Human PIK3R5 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PIK3R5 protein (His tag)
PDEH100963-02 100 µg

Recombinant Human PIK3R5 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PIK3R5 protein (His tag)
PDEH100963-03 500 µg

Recombinant Human PIK3R5 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PIK3R5 protein (His tag)
PDEH100963-04 1 mg

Recombinant Human PIK3R5 protein (His tag)

Sign In for Pricing
View Details
IQGAP2 Human Knockdown Lysate
LY300007 100 µg

IQGAP2 Human Knockdown Lysate

Sign In for Pricing
View Details