Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2) spans the amino acid sequence from region 1-114.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhC2, Mrp complex subunit C2, Putative NADH-ubiquinone oxidoreductase subunit mnhC2

UniProt

A7WZ78

Expression Region

1-114

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITG GNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galnt3 Peptide - N-terminal region
orb2010592 100 µg

Galnt3 Peptide - N-terminal region

Sign In for Pricing
View Details
NADH Dehydrogenase [ubiquinone] iron-sulfur protein 2 mitochondrial (NDUFS2) Human ELISA Kit
F2598 96 Tests

NADH Dehydrogenase [ubiquinone] iron-sulfur protein 2 mitochondrial (NDUFS2) Human ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD62P/SELP Antibody (SAA0028), APC
MBS1583413-01 50 Tests

Anti-Human CD62P/SELP Antibody (SAA0028), APC

Sign In for Pricing
View Details
Anti-Human CD62P/SELP Antibody (SAA0028), APC
MBS1583413-02 100 Tests

Anti-Human CD62P/SELP Antibody (SAA0028), APC

Sign In for Pricing
View Details
Anti-Human CD62P/SELP Antibody (SAA0028), APC
MBS1583413-03 5x 100 Tests

Anti-Human CD62P/SELP Antibody (SAA0028), APC

Sign In for Pricing
View Details
EPOR Rabbit pAb
MBS8545106-01 0.1 mL

EPOR Rabbit pAb

Sign In for Pricing
View Details