Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt3 Peptide - N-terminal region

Galnt3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC124508, Galnt3

UniProt

Q3T1J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt3 Rabbit Polyclonal Antibody (orb579796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015032

Preservative

Lyophilized powder

AA Sequence

PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ADAMTS4/ADAMTS4 Antibody Picoband®, APC Conjugate
PA1479-APC 100 µg/Vial

Anti-ADAMTS4/ADAMTS4 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
BRF1 Blocking Peptide
MBS9623566-01 1 mg

BRF1 Blocking Peptide

Sign In for Pricing
View Details
BRF1 Blocking Peptide
MBS9623566-02 5x 1 mg

BRF1 Blocking Peptide

Sign In for Pricing
View Details
Goat anti-Cofilin 2 (muscle) Antibody
dAP-0693 50 µg

Goat anti-Cofilin 2 (muscle) Antibody

Sign In for Pricing
View Details
Mouse Insig2 activation kit by CRISPRa
GA209385 1 Kit

Mouse Insig2 activation kit by CRISPRa

Sign In for Pricing
View Details
S-arrestin
AP80743-01 50 µg

S-arrestin

Sign In for Pricing
View Details