Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D)

This Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1D (CAB1D) spans the amino acid sequence from region 1-116.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1D, LHCII type I CAB-1D, LHCP

UniProt

P10707

Expression Region

1-116

Origin

Solanum lycopersicum (Tomato) (Lycopersicon esculentum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAV Quantification Kit
63800 24 Reactions

AAV Quantification Kit

Sign In for Pricing
View Details
MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL
BNCB0410-100 1x 100 µL

MALT-1 (MT1/410), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf28 (MFSD12) (NM_001042680) Human Over-expression Lysate
LY421021 100 µg

C19orf28 (MFSD12) (NM_001042680) Human Over-expression Lysate

Sign In for Pricing
View Details
ATXN10 Antibody
KC-3176-01 50 μL

ATXN10 Antibody

Sign In for Pricing
View Details
ATXN10 Antibody
KC-3176-02 100 µL

ATXN10 Antibody

Sign In for Pricing
View Details
ATXN10 Antibody
KC-3176-03 1 mL

ATXN10 Antibody

Sign In for Pricing
View Details