Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165)

This Recombinant Human Putative uncharacterized protein C14orf165 (C14orf165) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C14orf165

UniProt

Q86U02

Expression Region

1-117

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTLLLSNYYSRLEGWMMDNNFSHHWKGMFPTETESTVFCLFVYLFIFVFETASGFVAQT GVHWCNLGSLQPLPPGFKRFSCLSLPSSLDYRHAPPCLANFYIFSGDRVSPCWPDWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT4B (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, GlcNAc-T IVb, GnT-IVb, N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb, UNQ906/PRO1927) (Not for Export EU)
129620 100 µL

MGAT4B (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, GlcNAc-T IVb, GnT-IVb, N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb, UNQ906/PRO1927) (Not for Export EU)

Sign In for Pricing
View Details
Fstl1 Rat shRNA Lentiviral Particle (Locus ID 79210)
TL711030V 500 µL Each

Fstl1 Rat shRNA Lentiviral Particle (Locus ID 79210)

Sign In for Pricing
View Details
Olfr583 Protein Vector (Mouse) (pPM-C-HA)
33276024 500 ng

Olfr583 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Antitumor agent-182
orb2664182-01 50 mg

Antitumor agent-182

Sign In for Pricing
View Details
Antitumor agent-182
orb2664182-02 10 mg

Antitumor agent-182

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1236340-01 0.02 mg (E-Coli)

Recombinant Teredinibacter turnerae Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details