Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

A7X0F5

Expression Region

1-118

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dgkh ORF Vector (Mouse) (pORF)
ORF042961 1.0 µg DNA

Dgkh ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
P27 Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1) discontinued
224742-01 50 µL

P27 Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1) discontinued

Sign In for Pricing
View Details
P27 Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1) discontinued
224742-02 100 µL

P27 Kip1 (Cyclin-Dependent Kinase Inhibitor 1B, Cyclin-Dependent Kinase Inhibitor, p27, p27Kip1, CDKN1B, KIP1) discontinued

Sign In for Pricing
View Details
PCMV-CIDEC (rat) -3xFLAG-Neo
BZ50904 1 Vial

PCMV-CIDEC (rat) -3xFLAG-Neo

Sign In for Pricing
View Details
LINC00597 Protein Lysate (Human) with C-Ha Tag
26862031 100 µg

LINC00597 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MRTF-A-IN-1
HY-162968 1 Each

MRTF-A-IN-1

Sign In for Pricing
View Details