Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf92 (C11orf92)

This Recombinant Human Uncharacterized protein C11orf92 (C11orf92) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf92

UniProt

Q6ZS62

Expression Region

1-124

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQ GVCKDSKDLFVPTSSSLYGCFCVGLVSGMAISVLLLASDFRKLDFSRPEPCFEKEASLWF VAQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PRLR Protein, C-His
EHD18001 100 μg

Recombinant Human PRLR Protein, C-His

Sign In for Pricing
View Details
GGT1/2 (A-4) : m-IgG1 BP-HRP Bundle
sc-544122 1 Kit

GGT1/2 (A-4) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
IKK gamma (IKBKG) (NM_001099857) Human Mass Spec Standard
PH318044 10 µg

IKK gamma (IKBKG) (NM_001099857) Human Mass Spec Standard

Sign In for Pricing
View Details
HGASR full length protein-synthetic nanodisc
orb2707861-01 10 µg

HGASR full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HGASR full length protein-synthetic nanodisc
orb2707861-02 50 µg

HGASR full length protein-synthetic nanodisc

Sign In for Pricing
View Details
LTβR-IN-1
orb1709239-01 1 mg

LTβR-IN-1

Sign In for Pricing
View Details