Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fumarate reductase subunit D (frdD)

This Recombinant Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

P67644

Expression Region

1-125

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPSTSDARSRRRSAEPFLWLLFSAGGMVTALVAPVLLLLFGLAFPLGWLDAPDHGHLLA MVRNPITKLVVLVLVVLALFHAAHRFRFVLDHGLQLGRFDRVIALWCYGMAVLGSATAGW MLLTM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK36 Protein Vector (Rat) (pPM-C-His)
PV308645 500 ng

STK36 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Shq1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3430205 3x 1.0 µg

Shq1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Benzyl glycolate
OR917631-01 25 g

Benzyl glycolate

Sign In for Pricing
View Details
Benzyl glycolate
OR917631-02 100 g

Benzyl glycolate

Sign In for Pricing
View Details
Benzyl glycolate
OR917631-03 2.5 Kg

Benzyl glycolate

Sign In for Pricing
View Details
RET Mouse Monoclonal Antibody [Clone ID: LBI4H3]
AMM17050VCF 100 µg

RET Mouse Monoclonal Antibody [Clone ID: LBI4H3]

Sign In for Pricing
View Details