Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Preprotein translocase subunit SecE (secE)

This Recombinant Preprotein translocase subunit SecE (secE) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Preprotein translocase subunit SecE

UniProt

P0A2D4

Expression Region

1-127

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSANTEAQGSGRGLEAMKWIVVAILLIVAIVGNYLYRDMMLPLRALAVVILIAAAGGVAL LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS FITGLRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DID (DIIC18 (5) ), 5x1mg
#60014-5mg 5x 1 mg

DID (DIIC18 (5) ), 5x1mg

Sign In for Pricing
View Details
AD-mix-beta (Technical Grade)
TRC-A200005-250MG 250 mg

AD-mix-beta (Technical Grade)

Sign In for Pricing
View Details
Mitochondrial Complex V (F0F1-ATPase/ATP Synthase) Activity Assay Kit
E-BC-K153-M-01 48 T (24 samples)

Mitochondrial Complex V (F0F1-ATPase/ATP Synthase) Activity Assay Kit

Sign In for Pricing
View Details
Mitochondrial Complex V (F0F1-ATPase/ATP Synthase) Activity Assay Kit
E-BC-K153-M-02 96 T (48 samples)

Mitochondrial Complex V (F0F1-ATPase/ATP Synthase) Activity Assay Kit

Sign In for Pricing
View Details
ADAMTSL5 Human Gene Knockout Kit (CRISPR)
KN421003 1 Kit

ADAMTSL5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS702513 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details