Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Movement protein TGB2 (ORF3)

This Recombinant Movement protein TGB2 (ORF3) spans the amino acid sequence from region 1-127.

Product Specifications

Product Name Alternative

Movement protein TGB2, 12 kDa protein, Triple gene block 2 protein, TGBp2

UniProt

P22170

Expression Region

1-127

Origin

Foxtail mosaic virus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLSHGTGAPAISTPLTLRPPPDNTKAILTIAIGIAASLVFFMLTRNNLPHVGDNIHSLP HGGSYIDGTKSINYRPPASRYPSSNLLAFAPPILAAVLFFLTQPYLATRRSRCVRCFVVH GACTNHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ampd1 siRNA Oligos set (Mouse)
11850174 3x 5 nmol

Ampd1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
S 0960
MBS5813228 Inquire

S 0960

Sign In for Pricing
View Details
Anti-RAB7L1 RAB29 Antibody
A30753 100 µL

Anti-RAB7L1 RAB29 Antibody

Sign In for Pricing
View Details
CD4 (RIV6)
sc-52385 200 µg/mL

CD4 (RIV6)

Sign In for Pricing
View Details
Human TMEM27 (Transmembrane Protein 27) ELISA Kit
EH25517 96 Tests

Human TMEM27 (Transmembrane Protein 27) ELISA Kit

Sign In for Pricing
View Details
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (APC)
MBS6167259-01 0.1 mL

OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (APC)

Sign In for Pricing
View Details