Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian Large-conductance mechanosensitive channel (mscL)

This Recombinant Bacillus thuringiensis subsp. konkukian Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-132.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q6HCK7

Expression Region

1-132

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWNEFKKFAFKGNVIDLAVGVVIGAAFGKIVSSLVKDIITPLLGMVLGGVDFTDLKITFG KSSIMYGNFIQTIFDFLIIAAAIFMFVKVFNKLTSKREEEKEEEIPEPTKEEELLGEIRD LLKQQNSSKDRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSWIM3 ORF Vector (Human) (pORF)
51983011 1.0 µg DNA

ZSWIM3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HINT2, 18-163aa, Human, His tag, E Coli
MBS205203-01 0.01 mg

HINT2, 18-163aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HINT2, 18-163aa, Human, His tag, E Coli
MBS205203-02 0.05 mg

HINT2, 18-163aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HINT2, 18-163aa, Human, His tag, E Coli
MBS205203-03 5x 0.01 mg

HINT2, 18-163aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HINT2, 18-163aa, Human, His tag, E Coli
MBS205203-04 0.25 mg

HINT2, 18-163aa, Human, His tag, E Coli

Sign In for Pricing
View Details
HINT2, 18-163aa, Human, His tag, E Coli
MBS205203-05 5x 0.05 mg

HINT2, 18-163aa, Human, His tag, E Coli

Sign In for Pricing
View Details