Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Cytochrome b5 (Cyb5a)

This Recombinant Rat Cytochrome b5 (Cyb5a) spans the amino acid sequence from region 2-134.

Product Specifications

Product Name Alternative

Cytochrome b5

UniProt

P00173

Expression Region

2-134

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AEQSDKDVKYYTLEEIQKHKDSKSTWVILHHKVYDLTKFLEEHPGGEEVLREQAGGDATE NFEDVGHSTDARELSKTYIIGELHPDDRSKIAKPSETLITTVESNSSWWTNWVIPAISAL VVALMYRLYMAED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-HPG-CoA
TRC-D795460-10MG 10 mg

D-HPG-CoA

Sign In for Pricing
View Details
LKB1 (STK11) Human Gene Knockout Kit (CRISPR)
KN202885 1 Kit

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Septin 3 (SEPT3) (NM_145733) Human Over-expression Lysate
LC403438 20 µg

Septin 3 (SEPT3) (NM_145733) Human Over-expression Lysate

Sign In for Pricing
View Details
Melanoma gp100 Recombinant Rabbit Monoclonal Antibody [JE42-47]
HA721719 100 µL

Melanoma gp100 Recombinant Rabbit Monoclonal Antibody [JE42-47]

Sign In for Pricing
View Details
IPPK Antibody
8C11708-AAT 50 µg

IPPK Antibody

Sign In for Pricing
View Details
Sucrase Activity Assay Kit
E-BC-K751-M 96 T (40 samples)

Sucrase Activity Assay Kit

Sign In for Pricing
View Details