Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Large-conductance mechanosensitive channel (mscL)

This Recombinant Enterobacter sp. Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A4WF99

Expression Region

1-137

Origin

Enterobacter sp. (strain 638)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIVKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVT LRDAQGDIPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNRKKEEPAAVPPAPSKEE VLLTQIRDLLKEQNNRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arachis hypogaea Gel -PNA- Immobilized Lectin
AK-2301-2 2 mL

Arachis hypogaea Gel -PNA- Immobilized Lectin

Sign In for Pricing
View Details
Recombinant MESDC2 Monoclonal Antibody
AN300356P 100 µL

Recombinant MESDC2 Monoclonal Antibody

Sign In for Pricing
View Details
Texas Red-X, succinimidyl ester *Single isomer* *178623-11-5*
474-AAT 5 mg

Texas Red-X, succinimidyl ester *Single isomer* *178623-11-5*

Sign In for Pricing
View Details
3,4-Dichlorobenzenesulfonamide
TRC-D438508-50MG 50 mg

3,4-Dichlorobenzenesulfonamide

Sign In for Pricing
View Details
3-Oxo-4-aza-5alpha-alphandrost-1-ene-17beta-carboxylic Acid
TRC-O847250-1G 1 g

3-Oxo-4-aza-5alpha-alphandrost-1-ene-17beta-carboxylic Acid

Sign In for Pricing
View Details
Recombinant Mouse Betacellulin/BTC Protein (His Tag)
PKSM040967-01 10 µg

Recombinant Mouse Betacellulin/BTC Protein (His Tag)

Sign In for Pricing
View Details