Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11 (NDUFA11) spans the amino acid sequence from region 2-141.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11, Complex I-B14.7, CI-B14.7, NADH-ubiquinone oxidoreductase subunit B14.7

UniProt

Q0MQB8

Expression Region

2-141

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTF TAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIA ASLVKMGQLEGWEVFAKPKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride
TRC-E925792-5MG 5 mg

11-(4-Ethyl-1-piperazinyl)-dibenzo[b,f][1,4]thiazepine-D5 Dihydrochloride

Sign In for Pricing
View Details
SARS-CoV-2-IN-22
MBS5805512 Inquire

SARS-CoV-2-IN-22

Sign In for Pricing
View Details
Lentiviral mouse Mex3b shRNA (UAS) - Lentiviral mouse Mex3b shRNA (UAS) plasmid
GTR15242323 1 Vial

Lentiviral mouse Mex3b shRNA (UAS) - Lentiviral mouse Mex3b shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human Tissue factor (F3), partial (Active)
CSB-MP007928HU2-01 10 µg

Recombinant Human Tissue factor (F3), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Tissue factor (F3), partial (Active)
CSB-MP007928HU2-02 50 µg

Recombinant Human Tissue factor (F3), partial (Active)

Sign In for Pricing
View Details
Recombinant Human Tissue factor (F3), partial (Active)
CSB-MP007928HU2-03 200 µg

Recombinant Human Tissue factor (F3), partial (Active)

Sign In for Pricing
View Details