Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial (Active)

Product Specifications

Abbreviation

Recombinant Human F3 protein, partial (Active)

Gene Name

F3

UniProt

P13726

Expression Region

33-251aa

Organism

Homo sapiens (Human)

Target Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU) . The EC50 is 1.434-1.635 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

References & Citations

Human tissue factor: cDNA sequence and chromosome localization of the gene. Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E. Biochemistry 26:5234-5238 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPK3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV666487 1.0 µg DNA

RIPK3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ACAD9 Polyclonal Antibody
A73475-100 100 µL

ACAD9 Polyclonal Antibody

Sign In for Pricing
View Details
MNF1 Adenovirus (Human)
30269051 1.0 mL

MNF1 Adenovirus (Human)

Sign In for Pricing
View Details
BAMBI (9K13) Mouse Monoclonal antibody
E28PE3367 100 µL

BAMBI (9K13) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Lithium acetate dihydrate pure
LC-10844.1 1 Kg

Lithium acetate dihydrate pure

Sign In for Pricing
View Details
Olr421 sgRNA CRISPR Lentivector set (Rat)
K7143301 3x 1.0 µg

Olr421 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details