Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein R213

UniProt

Q5UQ28

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSGRTSYDENTRQLYKLDDNGNFVFVENISLDNYFDLLIDIYRTNDPIDELDCCFKLHD MDTNTNNISDIIKASHSLPVNMGHIDPVFYLGYPVIFIIGVTYFSIIASRKINPSDRLLN EIKEYRLTCQNVYRKKFSINFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7092-5p miRNA Antagomir
MNM02961 2x 5.0 nmol

mmu-miR-7092-5p miRNA Antagomir

Sign In for Pricing
View Details
Recombinant Human Azurocidin/CAP37/HBP Protein (C-6His)
E53A05442 50 µg

Recombinant Human Azurocidin/CAP37/HBP Protein (C-6His)

Sign In for Pricing
View Details
Ltb4r2 (NM_020490) Mouse Tagged ORF Clone Lentiviral Particle
MR227336L4V 200 µL

Ltb4r2 (NM_020490) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
High frequency desktop ultrasonic Cleaner BULC-506
BULC-506 Each

High frequency desktop ultrasonic Cleaner BULC-506

Sign In for Pricing
View Details
Neuromedin B (porcine)
B5225-5 5 mg

Neuromedin B (porcine)

Sign In for Pricing
View Details
Tesmilifene (hydrochloride)
HY-13762A 1 Each

Tesmilifene (hydrochloride)

Sign In for Pricing
View Details