Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC)

This Recombinant Pseudomonas stutzeri Nitric oxide reductase subunit C (norC) spans the amino acid sequence from region 2-146.

Product Specifications

Product Name Alternative

Nitric oxide reductase subunit C, NOR small subunit, Nitric oxide reductase cytochrome c subunit

UniProt

Q52527

Expression Region

2-146

Origin

Pseudomonas stutzeri (Pseudomonas perfectomarina)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SETFTKGMARNIYFGGSVFFFLVFLGLTYHTEQTFPERTNESEMTEAVVRGKEVWENNNC IGCHSLLGEGAYFAPELGNVFVRRGGEETFKPFLHAWMKAQPLGAPGRRAMPQFNLSEQQ VDDMAEFLKWTSKIDTNDWPPNKEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human CD2 Antibody[G11]
AN00572D-01 20 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[G11]
AN00572D-02 100 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[G11]
AN00572D-03 2x 100 Tests

PE Anti-Human CD2 Antibody[G11]

Sign In for Pricing
View Details
Caspase 3/7 and DAPI Double Staining Kit
E-CK-A833-01 20 Assays

Caspase 3/7 and DAPI Double Staining Kit

Sign In for Pricing
View Details
Caspase 3/7 and DAPI Double Staining Kit
E-CK-A833-02 100 Assays

Caspase 3/7 and DAPI Double Staining Kit

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C2), CF640R conjugate, 0.1mg/mL
BNC400523-500 1x 500 µL

AFP (Alpha Fetoprotein) (C2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details