Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ORM1-like protein 3 (ORMDL3)

This Recombinant Human ORM1-like protein 3 (ORMDL3) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 3

UniProt

Q8N138

Expression Region

1-153

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV730599 1.0 µg DNA

KRT8P44 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
MST1R Protein Vector (Human) (pPM-C-HA)
30766021 500 ng

MST1R Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SCF Recombinant Protein
90-537 10 µg

SCF Recombinant Protein

Sign In for Pricing
View Details
Mouse KCNQ3 shRNA Plasmid
abx980111-01 150 µg

Mouse KCNQ3 shRNA Plasmid

Sign In for Pricing
View Details
Mouse KCNQ3 shRNA Plasmid
abx980111-02 300 µg

Mouse KCNQ3 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral human MRPL51 shRNA (UAS) - Lentiviral human MRPL51 shRNA (UAS) (100)
GTR15351273 1 Vial

Lentiviral human MRPL51 shRNA (UAS) - Lentiviral human MRPL51 shRNA (UAS) (100)

Sign In for Pricing
View Details