Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human ORM1-like protein 3 (ORMDL3)

This Recombinant Human ORM1-like protein 3 (ORMDL3) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

ORM1-like protein 3

UniProt

Q8N138

Expression Region

1-153

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SC5DL Antibody
NBP2-55973-25ul 25 µL

Rabbit Polyclonal SC5DL Antibody

Sign In for Pricing
View Details
PROTAC ERα Degrader-4
HY-149295-01 1 mg

PROTAC ERα Degrader-4

Sign In for Pricing
View Details
PROTAC ERα Degrader-4
HY-149295-02 5 mg

PROTAC ERα Degrader-4

Sign In for Pricing
View Details
PROTAC ERα Degrader-4
HY-149295-03 10 mg

PROTAC ERα Degrader-4

Sign In for Pricing
View Details
LBX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
26334061 1.0 µg DNA

LBX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human NPAT Pre-designed siRNA Set A
SI010715A 1 Each

Human NPAT Pre-designed siRNA Set A

Sign In for Pricing
View Details