Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD)
This Recombinant Synechococcus sp. Cytochrome b6-f complex subunit 4 (petD) spans the amino acid sequence from region 1-160.
Product Specifications
Product Name Alternative
Cytochrome b6-f complex subunit 4, 17 kDa polypeptide
UniProt
Q0ICP7
Expression Region
1-160
Origin
Synechococcus sp. (strain CC9311)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHILKKPDLTDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACIVGLSVLDPA MLGDKADPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLVPLGLMLIPFIESFNKF QNPFRRPIAMAVFLFGTATTIYLGIGAAMPIDKSLTLGLF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#20877-500uL 1x 500 µL
CF®505 Goat Anti-Rabbit IgG (H+L), Highly Cross-Adsorbed, single label for STORM, 1 mg/mL
Sign In for Pricing
View Details 
![RUNX3 Mouse Monoclonal Antibody [A7B7]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea823ef/imageurl/ha600058.webp)
BNC043243-500 1x 500 µL
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details