Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant General secretion pathway protein B (pulB)

This Recombinant General secretion pathway protein B (pulB) spans the amino acid sequence from region 1-174.

Product Specifications

Product Name Alternative

General secretion pathway protein B, Pullulanase operon protein PULB

UniProt

P20725

Expression Region

1-174

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVRPQEPYPQSEPPAAVGRMVQIPYVTVPLYAALLIALGWFGGEQWRNKPEPQPMRQSV AHAALVPLNQPAVKAAVAPVNAGPEIQAEPEIAIDEDNLPPLRYSAHVYASLADKRSIVL NGQSWKEGDSPLANLVIEHIQQDLTVFSFNGKTFTLAALDDWPGGAIEESPQAE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN26 sgRNA CRISPR Lentivector (Human) (Target 1)
K2509002 1.0 µg DNA

TRNAN26 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Prps1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3821403 1.0 µg DNA

Prps1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
6-[ (4-Methylphenyl) thio]-2-oxo-9- (2’,3’,5’-tri-O-acetyl-b-D-ribofuranosyl) -2,3-dihydropurine
M3529-75 200 mg

6-[ (4-Methylphenyl) thio]-2-oxo-9- (2’,3’,5’-tri-O-acetyl-b-D-ribofuranosyl) -2,3-dihydropurine

Sign In for Pricing
View Details
FRA8E Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV725869 1.0 µg DNA

FRA8E Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Anti-Ms CD26 PE
1P-776-C100 0.1 mg

Anti-Ms CD26 PE

Sign In for Pricing
View Details
Anti-Id3 Antibody
56209 100ug

Anti-Id3 Antibody

Sign In for Pricing
View Details