Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit b (atpF)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP synthase subunit b (atpF) spans the amino acid sequence from region 1-175.

Product Specifications

Product Name Alternative

ATP synthase subunit b, ATP synthase F (0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, F-ATPase subunit b

UniProt

Q49Z54

Expression Region

1-175

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTATTNMFVLGAAGTSGVQWGTIIVTLVTFLILLALLKKFAWGPLKDVMDKREHDINKDI DDAEQAKLNAQKLEEQNKQTLKETQDEVQKILEESKVQARKQHEEIIHEANIRANGMIET AQNEINSEKERAIADINNQVSELSVLIASKVLQKEISDKDQKALVEKYIKEAGDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Muffle Box Furnace (BER-3214)
BER-3214 1 Unit

Muffle Box Furnace (BER-3214)

Sign In for Pricing
View Details
Anti-SLC5A11 antibody
STJ115130 100 µl

Anti-SLC5A11 antibody

Sign In for Pricing
View Details
Human RAVER2 protein
orb246641-01 20 µg

Human RAVER2 protein

Sign In for Pricing
View Details
Human RAVER2 protein
orb246641-02 100 µg

Human RAVER2 protein

Sign In for Pricing
View Details
Human RAVER2 protein
orb246641-03 1 mg

Human RAVER2 protein

Sign In for Pricing
View Details
UFM1 Rabbit Polyclonal Antibody
TA365478 100 µL

UFM1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details