Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAVER2 protein

This Human RAVER2 protein spans the amino acid sequence from region 2-691aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAVER2

UniProt

Q9HCJ3

Expression Region

2-691aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

90.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQRMQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTGHSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPSDYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGSKVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQLCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQQLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pde6d-set siRNA/shRNA/RNAi Lentivector (Rat)
36292096 4x 500 ng

Pde6d-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0961R-BF594-01 20 µL

Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0961R-BF594-02 100 µL

Leptin receptor Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
REA (PHB2) Antibody (C-term)
orb1929410-01 50 µL

REA (PHB2) Antibody (C-term)

Sign In for Pricing
View Details
REA (PHB2) Antibody (C-term)
orb1929410-02 100 µL

REA (PHB2) Antibody (C-term)

Sign In for Pricing
View Details
Anti-CCR6/CCR6 Antibody Picoband® Fluoro647 Conjugated
PA1201-Fluoro647 100 µg/Vial

Anti-CCR6/CCR6 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details