Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable signal peptidase complex subunit 2 (Y37D8A.10)

This Recombinant Probable signal peptidase complex subunit 2 (Y37D8A.10) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Probable signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit

UniProt

Q9XWW1

Expression Region

1-180

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDEPVKVVNKWDGPTVKNALDEVVKKILNDKVGWTESHNLMNLRLLISFIGVAFSAFAC GYDYYEPFPKSKIVLAVCSVSYFICMGILQMYQWYVEKDCIYEATEVDGKQSRKWAWSSE IKAHDDKYTLSAEFKKEGRSGQGKITKSIGAYIDNDGEIIVPLVKKEVDDLYNRLIRSEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS717511 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Mouse GC (Glucagon) ELISA Kit
E-EL-M0555-01 24 Tests

Mouse GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details
Mouse GC (Glucagon) ELISA Kit
E-EL-M0555-02 48 Tests

Mouse GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details
Mouse GC (Glucagon) ELISA Kit
E-EL-M0555-03 96 Tests

Mouse GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details
Recombinant S100A9 Antibody
RC-4912-01 50 μL

Recombinant S100A9 Antibody

Sign In for Pricing
View Details
Recombinant S100A9 Antibody
RC-4912-02 100 µL

Recombinant S100A9 Antibody

Sign In for Pricing
View Details