What is the catalog number for Recombinant Vaccinia virus Protein H2 (H2R)?

The catalog number for Recombinant Vaccinia virus Protein H2 (H2R) is orb2929763.

What sizes are available for Recombinant Vaccinia virus Protein H2 (H2R)?

Recombinant Vaccinia virus Protein H2 (H2R) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Vaccinia virus Protein H2 (H2R) come in?

Recombinant Vaccinia virus Protein H2 (H2R) is available in 2 different pack sizes.

Is Recombinant Vaccinia virus Protein H2 (H2R) in stock?

Recombinant Vaccinia virus Protein H2 (H2R) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Vaccinia virus Protein H2 (H2R)

This Recombinant Vaccinia virus Protein H2 (H2R) spans the amino acid sequence from region 1-189.

Product Specifications

Product Name Alternative

Protein H2

UniProt

P20496

Expression Region

1-189

Origin

Vaccinia virus (strain Copenhagen) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKTTLSVNACNLEYVREKAIVGVQAAKTSTLIFFVIILAISALLLWFQTSDNPVFNELT RYMRIKNTVNDWKSLTDSKTKLESDRGKLLAAGKDDIFEFKCVDFGAYFIAMRLDKKTYL PQAIRRGTGDAWMVKKAAKVDPSAQQFCQYLIKHKSNNVITCGNEMLNELGYSGYFMSPH WCSDFSNME