Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kineococcus radiotolerans Potassium-transporting ATPase C chain (kdpC)

This Recombinant Kineococcus radiotolerans Potassium-transporting ATPase C chain (kdpC) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Potassium-transporting ATPase C chain, EC= 3.6.3.12, ATP phosphohydrolase [potassium-transporting] C chain, Potassium-binding and translocating subunit C, Potassium-translocating ATPase C chain

UniProt

A6W6R7

Expression Region

1-196

Origin

Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLALTNLLRQARTGLLLLLVATAGLGLVYPLAVFAVGRLVPARADGQVVAVDGQPVGSR LIGQEFPGEQWFQPRPSAAGDGYDPTASGASNLGPESTDLLKAVEERRAAVAAADGTAPV DVAPDALTASGSGLDPHVSPENARRQVARVAAARGLSEQRVAALVAEHTRGRALGFLGEP TVNVLELNLALRSAAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-DON-Boc
HY-153151 1 Each

Fmoc-DON-Boc

Sign In for Pricing
View Details
SHFM5 Recombinant Protein (Human)
RP096822 100 µg

SHFM5 Recombinant Protein (Human)

Sign In for Pricing
View Details
Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)
MBS1581500-01 0.1 mg

Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)

Sign In for Pricing
View Details
Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)
MBS1581500-02 1 mg

Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)

Sign In for Pricing
View Details
Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)
MBS1581500-03 5x 1 mg

Research Grade Anti-Human CD137/TNFRSF9/4-1BB (LVGN6051)

Sign In for Pricing
View Details
Cytokeratin 4 Rabbit Monoclonal Antibody
E49Y5792 100 µL

Cytokeratin 4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details